DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Mcpt8

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_032598.1 Gene:Mcpt8 / 17231 MGIID:1261780 Length:247 Species:Mus musculus


Alignment Length:247 Identity:75/247 - (30%)
Similarity:116/247 - (46%) Gaps:20/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLLLLGDASDVEAT-GRIIGGSDQLIRNAPWQVSIQIS---ARHECGGVIYSKEIIITAGHCLH 71
            |:|:||..|..|.|. |.||.|::....:.|:...|:.:   :.:.|||.:.:::|::||.||  
Mouse     3 LLLVLLVAALPVNAEGGEIIWGTESKPHSRPYMAYIRFNDSKSVYRCGGFLVARDIVMTAAHC-- 65

  Fly    72 ERSVTLMKVRVGAQN--HNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRL--STPLTFGLSTRAI 132
              :..::.|.:|..|  ......|:||:....||.||:..|..||.:|:|  ...|...:.|.|:
Mouse    66 --NGKVINVTLGIHNLKKKKNTQLIPVSEAIPHESFDNETLVNDIMLLKLERKAQLNSAVDTIAL 128

  Fly   133 NLASTSPSGGTTVTVTGWGHTDNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETICAAST 197
            ..:......|...||.|||...|..|||:||:..|::....:|.|....|....    .:|..:.
Mouse   129 PKSKDWVKPGQVCTVAGWGKLANCTLSDTLQEVNLEVQKGQKCRSMSQTYNDSI----QLCVGNP 189

  Fly   198 DADACT--GDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVK 247
            ..:..|  ||||||.|.:..:.||||  .|......|.|:..::...|||.|
Mouse   190 SENKATGKGDSGGPFVCNGVVQGIVS--CRLCTGTLPRVFTRISSFMPWIRK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 64/226 (28%)
Tryp_SPc 28..247 CDD:238113 66/227 (29%)
Mcpt8NP_032598.1 Tryp_SPc 20..237 CDD:214473 64/226 (28%)
Tryp_SPc 21..240 CDD:238113 67/229 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6600
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.