DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Tpsb2

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:242 Identity:80/242 - (33%)
Similarity:118/242 - (48%) Gaps:29/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IIGGSDQLIRNAPWQVSIQISAR---HECGGVIYSKEIIITAGHCL--HERSVTLMKVRVGAQNH 87
            |:||.:......|||||::....   |.|||.:...:.::||.||:  |.:|..|.:|::..|..
Mouse    32 IVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYL 96

  Fly    88 NYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINL--ASTSPSGGTTVTVTGW 150
            .||..|:.:....||..:.:.....|:|:|.|..|:........|:|  ||.:...||:..||||
Mouse    97 YYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVPVNVSTHLHPISLPPASETFPPGTSCWVTGW 161

  Fly   151 GHTDNGALSDS-------LQKAQLQIIDRGECASQKFGYGA----DF--VGEETICAASTDADAC 202
            |..||    |.       |::.::.|::...| .:|:..|.    ||  |.:..:||.:|..|:|
Mouse   162 GDIDN----DEPLPPPYPLKQVKVPIVENSLC-DRKYHTGLYTGDDFPIVHDGMLCAGNTRRDSC 221

  Fly   203 TGDSGGPLVASSQ----LVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            .||||||||...:    ..|:||||..||..|.||:|..|.....||
Mouse   222 QGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 78/240 (33%)
Tryp_SPc 28..247 CDD:238113 80/242 (33%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 80/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.