DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and PRSS36

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:253 Identity:80/253 - (31%)
Similarity:111/253 - (43%) Gaps:28/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTL----- 77
            |....|.:.||:|||:......|||||:.....|.|||.:.:...:::|.||..... ||     
Human    37 DCGRPEPSARIVGGSNAQPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFMTNG-TLEPAAE 100

  Fly    78 MKVRVGAQNHNYGGTL-----VPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINL--A 135
            ..|.:|.  |:..|.|     ..|||..|...:....|..|:|:|||::|.:.|.:...:.|  |
Human   101 WSVLLGV--HSQDGPLDGAHTRAVAAIVVPANYSQVELGADLALLRLASPASLGPAVWPVCLPRA 163

  Fly   136 STSPSGGTTVTVTGWG---HTDNGALSDSLQKAQLQIIDRGECA---SQKFGYGADF-VGEETIC 193
            |.....||....||||   ..|...|...||:.:|:::....|.   ||...:.... :....:|
Human   164 SHRFVHGTACWATGWGDVQEADPLPLPWVLQEVELRLLGEATCQCLYSQPGPFNLTLQILPGMLC 228

  Fly   194 AASTDA--DACTGDSGGPLVASSQ----LVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            |...:.  |.|.||||||||....    ..||.|:|:.|...|.|||:..||....||
Human   229 AGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGFGCGRRNRPGVFTAVATYEAWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 76/242 (31%)
Tryp_SPc 28..247 CDD:238113 77/243 (32%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 76/242 (31%)
Tryp_SPc 47..289 CDD:238113 77/243 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.