DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Prss28

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:248 Identity:66/248 - (26%)
Similarity:111/248 - (44%) Gaps:39/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IIGGSDQLIRNAPWQVSIQI------SARHECGGVIYSKEIIITAGHCLHERSV--TLMKVRVGA 84
            |:||........|||||:::      |..|.|||.|...:.|:||.||:..:..  .:.:|:||.
Mouse    31 IVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGE 95

  Fly    85 QNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGTT--VTV 147
            ........|:.::...:|..::.....:|:|:::|:..|....:...::|...|.:..:|  ..:
Mouse    96 VYLYKEQELLNISRIIIHPDYNDVSKRFDLALMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWL 160

  Fly   148 TGWGHTDNGALSDSLQKAQLQ-----------IIDRGEC--ASQKFG---YGADFVGEETICAAS 196
            .|||:.        ||:..||           |.|...|  |.:|..   :.|..:.::.:||.:
Mouse   161 VGWGNL--------LQRVPLQPPYQLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCAGT 217

  Fly   197 TDADACTGDSGGPLVASSQ----LVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            :....|.||||||||....    .||:||.|..|: :|.|.:::.|.....||
Mouse   218 SGRGPCFGDSGGPLVCWKSNKWIQVGVVSKGIDCS-NNLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 64/246 (26%)
Tryp_SPc 28..247 CDD:238113 66/248 (27%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 66/248 (27%)
Tryp_SPc 31..269 CDD:214473 64/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.