DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Prss1

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_444473.1 Gene:Prss1 / 114228 MGIID:98839 Length:246 Species:Mus musculus


Alignment Length:258 Identity:86/258 - (33%)
Similarity:135/258 - (52%) Gaps:26/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VATVLVLLLLGD--ASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHC 69
            ::.:|.|.|:|.  |..|:...:|:||......:.|:|||:. |..|.|||.:.:.:.:::|.||
Mouse     1 MSALLFLALVGAAVAFPVDDDDKIVGGYTCRENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHC 64

  Fly    70 LHERSVTLMKVRVGAQNHN-YGGTLVPVAAYKV--HEQFDSRFLHYDIAVLRLSTPLTFGLSTRA 131
            ...|    ::||:|..|.| ..|....:.|.|:  |..|:.:.|:.||.:::||:|:|.......
Mouse    65 YKTR----IQVRLGEHNINVLEGNEQFIDAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVAT 125

  Fly   132 INLASTSPSGGTTVTVTGWGHTDNGALS--DSLQKAQLQIIDRGECASQKFGYGADFVGEET--- 191
            :.|.|:....||...::|||:|.:..:|  |.||.....::.:.:|.       |.:.|:.|   
Mouse   126 VALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCE-------ASYPGKITGNM 183

  Fly   192 ICAASTDA--DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWI--VKAAN 250
            :||...:.  |:|.||||||:|.:.:|.|||||||.||..:.||||..|.....||  ..|||
Mouse   184 VCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 75/227 (33%)
Tryp_SPc 28..247 CDD:238113 77/230 (33%)
Prss1NP_444473.1 Tryp_SPc 23..239 CDD:214473 75/227 (33%)
Tryp_SPc 24..242 CDD:238113 77/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.