DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Try5

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:256 Identity:87/256 - (33%)
Similarity:134/256 - (52%) Gaps:26/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TVLVLLLLGD--ASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLH 71
            ::|.|.|:|.  |..|:...:|:||......:.|:|||:. |..|.|||.:.:.:.:::|.||..
Mouse     3 SLLFLALVGAAVAFPVDDDDKIVGGYTCRENSIPYQVSLN-SGYHFCGGSLINDQWVVSAAHCYK 66

  Fly    72 ERSVTLMKVRVGAQNHN-YGGTLVPVAAYKV--HEQFDSRFLHYDIAVLRLSTPLTFGLSTRAIN 133
            .|    ::||:|..|.| ..|....|.:.|:  |..|:||.|:.||.:::|::|:|.......:.
Mouse    67 TR----IQVRLGEHNINVLEGNEQFVNSAKIIKHPNFNSRTLNNDIMLIKLASPVTLNARVATVA 127

  Fly   134 LASTSPSGGTTVTVTGWGHTDNGALS--DSLQKAQLQIIDRGECASQKFGYGADFVGEET---IC 193
            |.|:....||...::|||:|.:..::  |.||.....::.:.:|.       |.:.|:.|   ||
Mouse   128 LPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCE-------ASYPGKITNNMIC 185

  Fly   194 AASTDA--DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWI--VKAAN 250
            ....:.  |:|.||||||:|.:.||.|||||||.||..:.||||..|.....||  ..|||
Mouse   186 VGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDTIAAN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 76/227 (33%)
Tryp_SPc 28..247 CDD:238113 78/230 (34%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 76/227 (33%)
Tryp_SPc 24..242 CDD:238113 78/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.