DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Try5

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_008761147.1 Gene:Try5 / 103690254 RGDID:1560283 Length:246 Species:Rattus norvegicus


Alignment Length:244 Identity:83/244 - (34%)
Similarity:126/244 - (51%) Gaps:24/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTLMKVRVG 83
            |..::...:|:||......:.|:|||:. |..|.|||.:.:.:.:::|.||...|    ::||:|
  Rat    15 AFPIDDDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCYKSR----IQVRLG 74

  Fly    84 AQNHN-YGGTLVPVAAYKV--HEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGTTV 145
            ..|.| ..|....|.|.|:  |..|::|.|:.||.:::||.|:|.......:.|.|:....||..
  Rat    75 EHNINVLEGNEQFVNAAKIIKHPNFNARNLNNDIMLIKLSVPVTLNSRVATVALPSSCAPAGTQC 139

  Fly   146 TVTGWGHTDNGALS--DSLQKAQLQIIDRGECASQKFGYGADFVGEET---ICAASTDA--DACT 203
            .::|||:|.:..::  |.||.....::.:.:|.       |.:.|:.|   ||....:.  |:|.
  Rat   140 LISGWGNTLSLGVNNPDLLQCLDAPVLPQADCE-------ASYPGKITNNMICVGFLEGGKDSCQ 197

  Fly   204 GDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWI--VKAAN 250
            ||||||:|.:.||.|||||||.||..:.||||..|.....||  ..|||
  Rat   198 GDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDTIAAN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 77/227 (34%)
Tryp_SPc 28..247 CDD:238113 79/230 (34%)
Try5XP_008761147.1 Tryp_SPc 23..239 CDD:214473 77/227 (34%)
Tryp_SPc 24..242 CDD:238113 79/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.