DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and LOC101730924

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_031761513.1 Gene:LOC101730924 / 101730924 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:255 Identity:88/255 - (34%)
Similarity:137/255 - (53%) Gaps:29/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERS 74
            :|:.:|||.|:..: ..:||||:.....:.|:.||:. |..|.|||.:.:.:.:::|.|| ::.|
 Frog     4 LLLCVLLGAAAAFD-DDKIIGGATCAKNSVPYIVSLN-SGYHFCGGSLINNQWVVSAAHC-YKAS 65

  Fly    75 VTLMKVRVGAQNHNYG---GTLVPVAAYKV--HEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINL 134
            :   :||:|  .||..   ||...:::.||  |..::|..|..||.:::||:..:...:..|:.|
 Frog    66 I---QVRLG--EHNIALSEGTEQFISSSKVIRHSGYNSWTLDNDIMLIKLSSAASLNAAVNAVAL 125

  Fly   135 ASTSPSGGTTVTVTGWGHT-DNGA-LSDSLQKAQLQIIDRGECASQKFGYGADFVGEET---ICA 194
            .|...:.||:..::|||:| .:|: ..|.||.....|:...:|.:.       :.||.|   ||.
 Frog   126 PSGCAAAGTSCLISGWGNTLSSGSNYPDLLQCLYAPILTDAQCNNA-------YPGEITNNMICL 183

  Fly   195 ASTDA--DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVK--AAN 250
            ...:.  |:|.||||||:|.:.||.|:|||||.||..||||||..|.....||..  |||
 Frog   184 GFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYNSWIQSTIAAN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 78/229 (34%)
Tryp_SPc 28..247 CDD:238113 80/230 (35%)
LOC101730924XP_031761513.1 Tryp_SPc 21..239 CDD:238113 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.