DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and LOC101730792

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_031762443.1 Gene:LOC101730792 / 101730792 -ID:- Length:146 Species:Xenopus tropicalis


Alignment Length:142 Identity:54/142 - (38%)
Similarity:75/142 - (52%) Gaps:14/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 AVLRLSTPLTFG--LSTRAINLASTSPSGGTTVTVTGWGHTD--NGALSDSLQKAQLQIIDRGEC 175
            |:|.|:.|..:.  :|...:.:...||..|....|:|||.|.  .|..||:|:..:|.|:...:|
 Frog     7 ALLPLNRPAFYNAFVSVVPLPIQGVSPIEGRLCQVSGWGFTSTIGGKPSDTLRSVKLPIVPMRKC 71

  Fly   176 ASQKFGYGADFVGEET---ICAA--STDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVY 235
            .|     .|.:.|..|   |||.  :...|||.||||||||...::.|:||||:.||:..|||||
 Frog    72 NS-----SASYAGHITSNMICAGFITGGKDACQGDSGGPLVCDGKVYGVVSWGHSCANPKYPGVY 131

  Fly   236 ADVAILRPWIVK 247
            ..||..:.||.:
 Frog   132 TAVANFQRWIYR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 52/138 (38%)
Tryp_SPc 28..247 CDD:238113 54/140 (39%)
LOC101730792XP_031762443.1 Tryp_SPc <7..141 CDD:214473 52/138 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.