DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Gm2663

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:246 Identity:69/246 - (28%)
Similarity:112/246 - (45%) Gaps:19/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLVLLLLGDASDVEATG--RIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHE 72
            :.....||.|..:.|..  :|:||......:.|:|||:.....|:|||.:.:.:.:::|.||...
Mouse     4 IFFFTFLGAAVALPANSDDKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLINDQWVLSAAHCYKR 68

  Fly    73 RSVTLMKVRVGAQNHNY--GGTLVPVAAYKV--HEQFDSRFLHYDIAVLRLSTPLTFGLSTRAIN 133
            |    ::||:|..|.:.  ||... :.|.|:  |..::...:..||.:::|.:|.........::
Mouse    69 R----LQVRLGEHNIDVLEGGEQF-IDAEKIIRHPDYNKDTVDNDIMLIKLKSPAILNSQVSTVS 128

  Fly   134 LASTSPSGGTTVTVTGWGHTDN--GALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETICAAS 196
            |..:..|......|:|||:|.:  |.....||..:..::....|.....|.    :.....|...
Mouse   129 LPRSCASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQ----ITSNMFCLGF 189

  Fly   197 TDA--DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            .:.  |:|.||||||:|.:.::.||||||..||....||||..|.....||
Mouse   190 LEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 63/225 (28%)
Tryp_SPc 28..247 CDD:238113 65/226 (29%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 63/225 (28%)
Tryp_SPc 24..243 CDD:238113 65/226 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.