DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and gzm3.3

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001108166.1 Gene:gzm3.3 / 100001138 ZFINID:ZDB-GENE-070912-135 Length:257 Species:Danio rerio


Alignment Length:258 Identity:79/258 - (30%)
Similarity:121/258 - (46%) Gaps:23/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VATVLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLH 71
            :.|.|:||.:..|..:::  .||||......:.|:..||||:..|.|||::...:.::||.|||:
Zfish     3 LCTFLLLLAISLAGGMDS--GIIGGKVAKAHSRPYMASIQINKHHTCGGMLIRDDYVLTAAHCLN 65

  Fly    72 ERSVTL----MKVRVGAQN---HNYGGTLVPVAAYKVHEQFD---SRFLHYDIAVLRLSTPLTFG 126
             |.|..    ::|.:||.|   |......:.|..|..|..|.   .:...|||.:|:|.......
Zfish    66 -RGVYSGRGHLEVVLGAHNISKHEQNQQRIQVKKYIRHPMFQRNKEKDYSYDIMLLKLKNKAKIS 129

  Fly   127 LSTRAINLASTSPS--GGTTVTVTGWGHTDNGA--LSDSLQKAQLQIIDRGECASQKFGYGADFV 187
            ...:.|:|...:..  .....:|.|||.|...|  .||.|::..|::....||   |..:...|.
Zfish   130 KFVKVISLPKKNGKIPANVKCSVAGWGLTKPKAELASDVLEEVTLKLQFDFEC---KTMWQQHFN 191

  Fly   188 GEETICAASTDADA-CTGDSGGPLVASSQLVGIVSWGY--RCADDNYPGVYADVAILRPWIVK 247
            .|..||:.|....| |.|||||||:.:::...|||:.:  .|.:..||.|:..::...|||.|
Zfish   192 TERMICSVSDGKHAFCQGDSGGPLICNTKPQAIVSYTFEGNCINKQYPQVFLKISYFLPWIKK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 71/234 (30%)
Tryp_SPc 28..247 CDD:238113 73/235 (31%)
gzm3.3NP_001108166.1 Tryp_SPc 22..255 CDD:238113 74/237 (31%)
Tryp_SPc 22..252 CDD:214473 71/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.