DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13202 and dnaaf19

DIOPT Version :10

Sequence 1:NP_610675.1 Gene:CG13202 / 36222 FlyBaseID:FBgn0033623 Length:81 Species:Drosophila melanogaster
Sequence 2:XP_012827164.1 Gene:dnaaf19 / 496703 XenbaseID:XB-GENE-922050 Length:247 Species:Xenopus tropicalis


Alignment Length:50 Identity:21/50 - (42%)
Similarity:34/50 - (68%) Gaps:2/50 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YELRNDAKLRAVY-STQNYEEFKNIVDAAHLRPVTKGDKANFKTKNRLWN 76
            |...||||.||:: ...:||||::||.|::|:|:.:.||...::| :.||
 Frog    48 YSRENDAKFRAIHQKVASYEEFRDIVLASNLKPLERKDKVGGESK-QPWN 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13202NP_610675.1 Dynein_attach_N 13..76 CDD:464912 19/48 (40%)
dnaaf19XP_012827164.1 Dynein_attach_N 29..96 CDD:464912 19/48 (40%)
RPAP3_C 120..206 CDD:464012
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.