| Sequence 1: | NP_610675.1 | Gene: | CG13202 / 36222 | FlyBaseID: | FBgn0033623 | Length: | 81 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_012827164.1 | Gene: | dnaaf19 / 496703 | XenbaseID: | XB-GENE-922050 | Length: | 247 | Species: | Xenopus tropicalis |
| Alignment Length: | 50 | Identity: | 21/50 - (42%) |
|---|---|---|---|
| Similarity: | 34/50 - (68%) | Gaps: | 2/50 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 28 YELRNDAKLRAVY-STQNYEEFKNIVDAAHLRPVTKGDKANFKTKNRLWN 76 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13202 | NP_610675.1 | Dynein_attach_N | 13..76 | CDD:464912 | 19/48 (40%) |
| dnaaf19 | XP_012827164.1 | Dynein_attach_N | 29..96 | CDD:464912 | 19/48 (40%) |
| RPAP3_C | 120..206 | CDD:464012 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||