DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and PRSS27

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:270 Identity:86/270 - (31%)
Similarity:135/270 - (50%) Gaps:48/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCL 73
            :|.||.         .|::..|:|||..|....:|||:|:||:|||.||||:.:...::|||||.
Human    22 AATACG---------RPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTAAHCF 77

  Fly    74 QSVS-ASVLQIRAGSSYWSSGG---VTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKA 134
            ::.| .|:.|:..|:......|   :...|...:::..|.......|:|::::...:.|::.|..
Human    78 RNTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILP 142

  Fly   135 IGLASSNPA----NGAAASVSGWGTLSYGSSSIPSQ---------LQYVNVNIVSQSQC-----A 181
            :.|  .:|:    .|....|:|||:        ||:         ||.:.|.|:...:|     .
Human   143 VCL--PDPSVIFETGMNCWVTGWGS--------PSEEDLLPEPRILQKLAVPIIDTPKCNLLYSK 197

  Fly   182 SSTYGYGSQ-IRSTMICAA--ASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVY 239
            .:.:||..: |::.|:||.  ...||||:||||||||    ...:..||:|||.|||..|.||||
Human   198 DTEFGYQPKTIKNDMLCAGFEEGKKDACKGDSGGPLVCLVGQSWLQAGVISWGEGCARQNRPGVY 262

  Fly   240 ADVAALRSWV 249
            ..|.|..:|:
Human   263 IRVTAHHNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 81/247 (33%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 81/247 (33%)
Tryp_SPc 36..275 CDD:238113 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.