DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Ctrc

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001029047.1 Gene:Ctrc / 76701 MGIID:1923951 Length:268 Species:Mus musculus


Alignment Length:273 Identity:90/273 - (32%)
Similarity:136/273 - (49%) Gaps:35/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALG---GTVPEGLLPQLDGRIVGGSATTISSFPWQISLQ----RSGSHSCGG 58
            ||...:|.:.:|||..   .|.|    |.|..|:|||.....:|:|||:|||    .:..|:|||
Mouse     1 MLGITVLAAILACASSCGDPTFP----PNLSARVVGGEDAVPNSWPWQVSLQYLRDDTWRHTCGG 61

  Fly    59 SIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWS------SGGVTFSVSSFKNHEGYNANTMVNDI 117
            |:.:::.::|||||:.    :.|..|.|...::      .|.|...|.:...||.:|...:.|||
Mouse    62 SLITTSHVLTAAHCIN----TNLTYRVGLGKYNLTVEDEEGSVYAEVDTIYVHEKWNRLLLWNDI 122

  Fly   118 AIIKINGALTFSSTIKAIGLASSN---PANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQ 179
            ||||:...:..|.||:...:...:   |.: ....|:|||.| :.:..|...||.....||:.:.
Mouse   123 AIIKLAEPVELSDTIQVACIPEQDSLLPGD-YPCYVTGWGRL-WTNGPIAEVLQQGLQPIVNHTT 185

  Fly   180 CASSTYGYGSQIRSTMICAAASGK-DACQGDSGGPL---VSGGV--LVGVVSWG--YGCAYSNYP 236
            |:...:.: .::|.||:||...|. .||.|||||||   |..|:  :.|:||:|  .||.....|
Mouse   186 CSRLDWWF-IKVRETMVCAGGDGVISACNGDSGGPLNCPVEDGLWQVHGIVSFGSSRGCNTYKKP 249

  Fly   237 GVYADVAALRSWV 249
            .|:..|:|...|:
Mouse   250 VVFTRVSAYIDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 79/239 (33%)
CtrcNP_001029047.1 Tryp_SPc 29..262 CDD:214473 79/239 (33%)
Tryp_SPc 30..265 CDD:238113 79/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.