DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss8

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:240 Identity:87/240 - (36%)
Similarity:128/240 - (53%) Gaps:22/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCL-QSVSASVLQIRAGS----SY 89
            ||.||.:.....:|||:|:...|:|.||||:.|:..:|:||||. :..|....:::.|:    ||
Mouse    44 RITGGGSAKPGQWPWQVSITYDGNHVCGGSLVSNKWVVSAAHCFPREHSREAYEVKLGAHQLDSY 108

  Fly    90 WSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPA--NGAAASVSG 152
             |:..|..:|:....|..|.......|||:|:::..:|||..|:.|.|.::|.:  ||...:|:|
Mouse   109 -SNDTVVHTVAQIITHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTG 172

  Fly   153 WGTLSYG-SSSIPSQLQYVNVNIVSQSQCASSTYGYGS------QIRSTMICA--AASGKDACQG 208
            ||.::.. |...|..||.:.|.::|:..| |..|...:      .|:..|:||  ...|||||||
Mouse   173 WGHVAPSVSLQTPRPLQQLEVPLISRETC-SCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQG 236

  Fly   209 DSGGPL---VSG-GVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||||||   :.| ..|.|:||||..|...|.||||...:...||:
Mouse   237 DSGGPLSCPMEGIWYLAGIVSWGDACGAPNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 86/238 (36%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 86/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.