DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss59

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001348859.1 Gene:Prss59 / 73481 MGIID:1920731 Length:251 Species:Mus musculus


Alignment Length:223 Identity:49/223 - (21%)
Similarity:93/223 - (41%) Gaps:31/223 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAG-------------SSYWSSGG 94
            |:.:.|| |....|.|::.....::|||||     :...:||.|             .:|     
Mouse    39 PYMVYLQ-SSPEPCVGTLIDPQWVLTAAHC-----SLPTKIRLGVYRPNIKNEKEQICNY----- 92

  Fly    95 VTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYG 159
             :|:|.    |..::|..:.||:.:||::...|.:..:..|.:|....|...:..:..|...:|.
Mouse    93 -SFTVV----HPNFDAKLLKNDLMLIKLSYPATINMYVGTIAIAMEPMAFNESCFIPTWTWNNYK 152

  Fly   160 SSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAAS--GKDACQGDSGGPLVSGGVLVG 222
            :.|.|..|.::|...:|.|.|..:.:....:.|..::|...|  ...|.:..|..|.:..|.:.|
Mouse   153 NLSDPDILTWINEYSLSPSDCLDTLHQQKQETRINIMCIGHSLNAMSATKEVSAAPAICSGRVHG 217

  Fly   223 VVSWGYGCAYSNYPGVYADVAALRSWVI 250
            ::|||.....:...|.:.::.....|::
Mouse   218 ILSWGKASVANGSKGFFTEIHPYARWIL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 48/220 (22%)
Prss59NP_001348859.1 Tryp_SPc 37..244 CDD:389826 48/220 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.