DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss52

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_082801.2 Gene:Prss52 / 73382 MGIID:1920632 Length:321 Species:Mus musculus


Alignment Length:281 Identity:89/281 - (31%)
Similarity:131/281 - (46%) Gaps:42/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILL----SAVACALG-------------GTVPEGLLPQLDGRIVGGSATTISSFPWQISL 48
            :|..|:||    |::|...|             ..:.||   :....||||....|..|||.:.:
Mouse    12 LLPLVLLLFGACSSLAWVCGRRMSSRSQQLNNASAIVEG---KPASAIVGGKPANILEFPWHVGI 73

  Fly    49 QRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTF-SVSSFKNHEGYNANT 112
            ...|||.|||||.:...:::|:||...::.|.|:|..|:...|:.|:.: .|.....|..::...
Mouse    74 MNHGSHLCGGSILNEWWVLSASHCFDQLNNSKLEIIHGTEDLSTKGIKYQKVDKLFLHPKFDDWL 138

  Fly   113 MVNDIAIIKINGALTFSSTIKAIGLASSNPANGAA---ASVSGWGTLSYGSSSI-PSQLQYVNVN 173
            :.||||::.:...|..|  :..|.:.:|..::..|   ..|:|||..:.....: |:.||.|.|:
Mouse   139 LDNDIALLLLKSPLNLS--VNRIPICTSEISDIQAWRNCWVTGWGITNTSEKGVQPTILQAVKVD 201

  Fly   174 IVSQSQCASSTYGY-GSQIRSTMICAAAS--GKDACQGDSGGPLVSG-------GVLVGVVSWGY 228
            :.....|     || .|.:...|:||...  |||||||||||.||..       ...||:||||.
Mouse   202 LYRWDWC-----GYILSLLTKNMLCAGTQDPGKDACQGDSGGALVCNKKRNTAIWYQVGIVSWGM 261

  Fly   229 GCAYSNYPGVYADVAALRSWV 249
            ||...|.||||..|:....|:
Mouse   262 GCGKKNLPGVYTKVSHYVRWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 79/233 (34%)
Prss52NP_082801.2 Tryp_SPc 56..285 CDD:238113 80/234 (34%)
Tryp_SPc 56..282 CDD:214473 79/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.