DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and XB5723326

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:231 Identity:63/231 - (27%)
Similarity:107/231 - (46%) Gaps:26/231 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FPWQISLQR----SGSHSCGGSIYSSNVIVTAAHCL----QSVSASVLQIRAGSSYWSSGGV--- 95
            :||.:|:|:    ...|.|.|:|.::..|:|||||.    :....:.|::..|:.|.|..|:   
 Frog    27 WPWIVSIQKKVELGYKHICAGTILNNEWIITAAHCFKDWKEGDPTTPLRVLLGTFYLSEIGLRTQ 91

  Fly    96 TFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIK--AIGLASSNPANGAAASVSGWGTLSY 158
            :..|.....|:.|:..|..||||:|:::..:.||..|:  .....|::..:....|::|||....
 Frog    92 SRGVKQLIKHDQYDPITESNDIALIQLDKQVEFSDHIQQACFPKESADLKDLIDCSIAGWGAQGK 156

  Fly   159 GSSSIPSQ-LQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLV----S 216
            .... ||| ||...|..:....|   ...|...:....:||.  ...:..|.||.|.||:    .
 Frog   157 HLDE-PSQFLQEAQVERIDTKHC---NKWYQGILGENHLCAGHRKGPEKTCNGDRGSPLMCRTKK 217

  Fly   217 GGV--LVGVVSWGYGCAYSNYPGVYADVAALRSWVI 250
            ..|  ::|:::||.||..:..||||:.:.:...|::
 Frog   218 NNVYSVIGILNWGSGCGQTRSPGVYSPIQSHIKWIV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 62/228 (27%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 62/228 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.