DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss44

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:248 Identity:83/248 - (33%)
Similarity:116/248 - (46%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQS-VSASVLQIRAGSSYWSSG 93
            |||||.......:|||:|||....|.||||:.|...::|||||:.. :..:|..  ..:..||..
Mouse   111 RIVGGRPAPARKWPWQVSLQVHKQHICGGSLISKWWVITAAHCVYGHLDYAVFM--GDADLWSKR 173

  Fly    94 GVTFSVSSFKNHEGYN-ANTMVNDIAIIKINGALTFSSTIKAIGLASSN----PANGAAASVSGW 153
            .|...|.....|:.:: ..|:|:|||::.:...:.:|..|:.:.:...:    |  |....|:||
Mouse   174 PVRIPVQDIIVHQDFSMMRTVVHDIALVLLAFPVNYSVNIQPVCIPEKSFLVQP--GTLCWVTGW 236

  Fly   154 G-TLSYGSSSIPSQLQYVNVNIVSQSQC----------------ASSTYGYGSQIRSTMICAAAS 201
            | .|..|.||  ..||.:.:||:...:|                .....||..:           
Mouse   237 GKVLEQGRSS--RILQEIELNIIRHEKCNQILKDIMGNIFTLVQEGGVCGYNEK----------- 288

  Fly   202 GKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVI 250
            |.||||||||||||    ...|.||:||||.||....|||||.:|:..|.|:|
Mouse   289 GGDACQGDSGGPLVCEFNKTWVQVGIVSWGLGCGRIGYPGVYTEVSYYRDWII 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 81/245 (33%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 111..340 CDD:214473 81/245 (33%)
Tryp_SPc 112..340 CDD:238113 80/244 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.