DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and TPSAB1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:271 Identity:89/271 - (32%)
Similarity:128/271 - (47%) Gaps:26/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVP-EGLLPQLDGRIVGGSATTISSFPWQISLQRSG---SHSCGGSIY 61
            ||..::|...|..:.....| .|...|..| ||||.....|.:|||:||:..|   .|.||||:.
Human     1 MLNLLLLALPVLASRAYAAPAPGQALQRVG-IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLI 64

  Fly    62 SSNVIVTAAHC----LQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKI 122
            ....::|||||    ::.::|..:|:|....|:..  ....||....|..:....:..|||::::
Human    65 HPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQD--QLLPVSRIIVHPQFYTAQIGADIALLEL 127

  Fly   123 NGALTFSSTIKAIGL--ASSNPANGAAASVSGWGTLSYGSS-SIPSQLQYVNVNIVSQSQCASST 184
            ...:..||.:..:.|  ||.....|....|:|||.:..... ..|..|:.|.|.|:....| .:.
Human   128 EEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHIC-DAK 191

  Fly   185 YGYGSQ-------IRSTMICAAASGKDACQGDSGGPL---VSGGVL-VGVVSWGYGCAYSNYPGV 238
            |..|:.       :|..|:||..:.:|:|||||||||   |:|..| .||||||.|||..|.||:
Human   192 YHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGI 256

  Fly   239 YADVAALRSWV 249
            |..|.....|:
Human   257 YTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 80/239 (33%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 81/240 (34%)
Tryp_SPc 31..267 CDD:214473 80/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.