DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and TMPRSS2

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:267 Identity:92/267 - (34%)
Similarity:130/267 - (48%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIV 67
            |.|:.|..:||.:      .|......|||||.:....::|||:||.....|.|||||.:...||
Human   271 KAVVSLRCIACGV------NLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIV 329

  Fly    68 TAAHCLQ---------SVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKIN 123
            |||||::         :..|.:|  |....::.:|   :.|....:|..|::.|..||||::|:.
Human   330 TAAHCVEKPLNNPWHWTAFAGIL--RQSFMFYGAG---YQVEKVISHPNYDSKTKNNDIALMKLQ 389

  Fly   124 GALTFSSTIKAIGLASSNPANGAAAS----VSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASS 183
            ..|||:..:|.:.|  .||.......    :|||| |...|.:|  ..|....|.::...:| :|
Human   390 KPLTFNDLVKPVCL--PNPGMMLQPEQLCWISGWGATEEKGKTS--EVLNAAKVLLIETQRC-NS 449

  Fly   184 TYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVSG----GVLVGVVSWGYGCAYSNYPGVYADV 242
            .|.|.:.|...||||.  ....|:||||||||||:.    ..|:|..|||.|||.:..||||.:|
Human   450 RYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNV 514

  Fly   243 AALRSWV 249
            .....|:
Human   515 MVFTDWI 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 85/238 (36%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:292133 5/11 (45%)
Tryp_SPc 292..521 CDD:214473 85/238 (36%)
Tryp_SPc 293..524 CDD:238113 85/239 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.