DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss41

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:260 Identity:78/260 - (30%)
Similarity:124/260 - (47%) Gaps:38/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSV------ 76
            ::|.|.......|||||..:....:|||.||:...||.||||:.|...::|||||.:..      
Mouse    71 SMPCGRRNDTRSRIVGGIESMQGRWPWQASLRLKKSHRCGGSLLSRRWVLTAAHCFRKYLDPEKW 135

  Fly    77 SASVLQIRAGSSYWS----SGG------VTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSST 131
            :..:.|:.:..|||:    ||.      :..|....|:|          |:|::::..::|::..
Mouse   136 TVQLGQLTSKPSYWNRKAYSGRYRVKDIIVNSEDKLKSH----------DLALLRLASSVTYNKD 190

  Fly   132 IKAIGLASS--NPANGAAASVSGWGTLSYGSSSIPS--QLQYVNVNIVSQSQCAS--STYGYGSQ 190
            |:.:.:..|  ...:.....|:|||.|......:|.  .|:.|.|:|::.|:|..  ..:.....
Mouse   191 IQPVCVQPSTFTSQHQPRCWVTGWGVLQEDLKPLPPPYHLREVQVSILNNSRCQELFEIFSLHHL 255

  Fly   191 IRSTMICAAA--SGKDACQGDSGGPLVSG--GV--LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |...:.||.|  ...|.|.||||||||..  |:  .:|:||||.||...|.||:|.:|:...:|:
Mouse   256 ITKDVFCAGAEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSWGIGCGRPNLPGIYTNVSHYYNWI 320

  Fly   250  249
            Mouse   321  320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/246 (30%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.