DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss22

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:279 Identity:94/279 - (33%)
Similarity:143/279 - (51%) Gaps:40/279 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTV---PEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYS 62
            :|..::||::.|.....|:   |:...||...|||||..:..:.:||.:|:.::|||.|.||:.:
Mouse    75 ILILLVLLTSTAPISAATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSILKNGSHHCAGSLLT 139

  Fly    63 SNVIVTAAHCLQS--VSASVLQIRAGSSYWSSG---------GVTFSVS----SFKNHEGYNANT 112
            :..:||||||.:|  ...|:..:..|:  |..|         |:.:.:.    |:|  ||.:|  
Mouse   140 NRWVVTAAHCFKSNMDKPSLFSVLLGA--WKLGSPGPRSQKVGIAWVLPHPRYSWK--EGTHA-- 198

  Fly   113 MVNDIAIIKINGALTFSSTIKAIGLASSN---PANGAAASVSGWGTLSYG-SSSIPSQLQYVNVN 173
               |||::::..::.||..|..|.|..|:   |.. ....::|||::..| ....|..||.:.|.
Mouse   199 ---DIALVRLEHSIQFSERILPICLPDSSVRLPPK-TDCWIAGWGSIQDGVPLPHPQTLQKLKVP 259

  Fly   174 IVSQSQCASSTY-GYGSQ-IRSTMICAA--ASGKDACQGDSGGPLV----SGGVLVGVVSWGYGC 230
            |:....|.|..: |.|.: |...|:||.  ...:|||.|||||||:    ...:|.|::|||.||
Mouse   260 IIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGEGC 324

  Fly   231 AYSNYPGVYADVAALRSWV 249
            |..|.||||..:.|.||||
Mouse   325 AERNRPGVYTSLLAHRSWV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 84/245 (34%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 85/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.