DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Gzmn

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_038949596.1 Gene:Gzmn / 691668 RGDID:1597226 Length:465 Species:Rattus norvegicus


Alignment Length:244 Identity:68/244 - (27%)
Similarity:105/244 - (43%) Gaps:24/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLPQLDG--RIVGGSATTISSFPWQI---SLQRSGSHS-CGGSIYSSNVIVTAAHCLQSVSASVL 81
            |||...|  .|:||......|:|:..   |::..|:.| |||.:.....::||||| :..|.:|:
  Rat   228 LLPLEAGAEEIIGGHEVKPHSYPYMAFIQSVKADGNISYCGGFLVQDYFVLTAAHC-EGESMTVM 291

  Fly    82 ----QIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNP 142
                .|:|......    ..||....:|..||......||.::|:......:..:..:.|..|:.
  Rat   292 LGAHNIKAKEDTQQ----IISVEKAISHPAYNKVDYSYDIMLLKLKSKAKRTKAVSTLMLPQSDA 352

  Fly   143 --ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASG--K 203
              ..|....|:|||..|...:.:.|.|:...:.|....:|....|.|   .::..|||....  :
  Rat   353 QVKPGDVCHVAGWGLTSINGTKVSSCLREAELIIQEDQECEKIFYNY---FKTIQICAGDPNNVQ 414

  Fly   204 DACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVISN 252
            ||.:||||||||......||:::|.....|:  ||:..|.....|:..|
  Rat   415 DASKGDSGGPLVCDNRAYGVIAYGKKGEISS--GVFTKVVYFLPWISRN 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 62/230 (27%)
GzmnXP_038949596.1 Tryp_SPc 21..>194 CDD:238113
Tryp_SPc 238..461 CDD:238113 63/232 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.