DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Tmprss11a

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_038948511.1 Gene:Tmprss11a / 686581 RGDID:1596322 Length:387 Species:Rattus norvegicus


Alignment Length:246 Identity:87/246 - (35%)
Similarity:128/246 - (52%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSS 88
            :|.:..|||.|:.....::|||:||||:..|.|||::..:..:||||||.::        .|...
  Rat   149 IPLIANRIVSGNPAAKGAWPWQVSLQRNNIHQCGGTLIGNMWVVTAAHCFRT--------NANPR 205

  Fly    89 YWS-SGGVTFSVSSFKN-------HEGYNANTMVNDIAIIKINGALTFSSTIKAIGL---ASSNP 142
            .|: |.|.|.:....|.       ||.|......:|||:::.:..:|||..::.|.|   ::|.|
  Rat   206 QWTLSFGTTINPPLMKREVRRIIMHEKYRPPARDHDIALVQFSPRVTFSDEVRRICLPEPSASFP 270

  Fly   143 ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA-ASG-KDA 205
            .| :...::|:|.|.||..| .::|:...|.|:|...| ...:.||::|:..|.||. ..| .||
  Rat   271 PN-STVYITGFGALYYGGES-QNELREARVQIISNDVC-KQRHVYGNEIKRGMFCAGFLEGIYDA 332

  Fly   206 CQGDSGGPLV-----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            |:||||||||     ....|:|:||||..|...|.||||..|...|.|:.|
  Rat   333 CRGDSGGPLVVRDDKDTWYLIGIVSWGDNCGQKNKPGVYTQVTYYRRWIAS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 84/236 (36%)
Tmprss11aXP_038948511.1 SEA 35..133 CDD:396113
Tryp_SPc 156..384 CDD:238113 85/239 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.