DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and LOC683849

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:251 Identity:91/251 - (36%)
Similarity:138/251 - (54%) Gaps:21/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            :::|:.|..|:...|.:      |.:||||.....:|.|:|:|| .||.|.||||:.:...:|:|
  Rat     4 LLILALVGTAVAFPVDD------DDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSA 61

  Fly    70 AHCLQSVSASVLQIRAGSSYWS--SGGVTF-SVSSFKNHEGYNANTMVNDIAIIKINGALTFSST 131
            |||.:    |.:|:|.|....:  .|...| :.:....|..::..|:.|||.:||::..:..::.
  Rat    62 AHCYK----SRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNAR 122

  Fly   132 IKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTM 195
            :..:.|.||....|....:|||| |||:|.:. |..||.::..::.|:.|.:|   |..:|...|
  Rat   123 VATVALPSSCAPAGTQCLISGWGNTLSFGVNE-PDLLQCLDAPLLPQADCEAS---YPGKITDNM 183

  Fly   196 ICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            :||.  ..|||:||||||||:|..|.|.|:||||||||..:.||||..|.....|:
  Rat   184 VCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 85/224 (38%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 85/224 (38%)
Tryp_SPc 24..242 CDD:238113 86/225 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.