DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and LOC683422

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006252253.1 Gene:LOC683422 / 683422 RGDID:1586868 Length:312 Species:Rattus norvegicus


Alignment Length:271 Identity:86/271 - (31%)
Similarity:125/271 - (46%) Gaps:31/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLS------AVACALG-GTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGG 58
            :|....|||      |..|..| .|.|  ||.:....|:||....||..||.:.:...|:|.|||
  Rat    11 LLPLAFLLSWAHSSQAWKCGQGLSTRP--LLQENVSAIMGGKPANISEVPWHVGIMNHGTHLCGG 73

  Fly    59 SIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTF-SVSSFKNHEGYNANTMVNDIAIIKI 122
            ||.:...:::|:||...::.:.|:||.|....|:..|.. .|.....|..::...:.||||::.:
  Rat    74 SILNEWWVLSASHCFDQINNANLEIRHGRDDLSTKNVKHEKVDKLILHPKFDDWLLDNDIALLLL 138

  Fly   123 NGALTFSSTIKAIGLASSNPAN---GAAASVSGWGTLSYGSSSI-PSQLQYVNVNIVSQSQCASS 183
            ...|..|  |..|.:.:|..::   .....|:|||..:.....: .::||.|.|::.....|   
  Rat   139 KSPLNLS--INGIPICTSELSDLRIWKNCWVTGWGITNVSGVKVQTTKLQKVQVDLFRWDWC--- 198

  Fly   184 TYGYG-SQIRSTMICAAA--SGKDACQGDSGGPLV-------SGGVLVGVVSWGYGCAYSNYPGV 238
              ||. ..:...|:||..  .|.|||||||||.||       :....||:||||.||...|.|||
  Rat   199 --GYVLPLLTKNMLCAGTPDGGMDACQGDSGGALVCNKKRNINTWYQVGIVSWGVGCGKKNLPGV 261

  Fly   239 YADVAALRSWV 249
            |..|:....|:
  Rat   262 YTKVSPYLKWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 74/233 (32%)
LOC683422XP_006252253.1 Tryp_SPc 46..275 CDD:238113 75/234 (32%)
Tryp_SPc 46..272 CDD:214473 74/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.