DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:254 Identity:106/254 - (41%)
Similarity:143/254 - (56%) Gaps:20/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            :|.:|.|:.:..|:  .:|   |...|.:||||.....::.|:|:|| .||.|.||||:.:|..:
Mouse     1 MKTLIFLAFLGAAV--ALP---LDDDDDKIVGGYTCQRNALPYQVSL-NSGYHFCGGSLINSQWV 59

  Fly    67 VTAAHCLQSVSASVLQIRAGSSYWSS--GGVTF-SVSSFKNHEGYNANTMVNDIAIIKINGALTF 128
            |:||||.:    |.:|:|.|.....:  ||..| ..:....|..|||||..|||.:||:..|.|.
Mouse    60 VSAAHCYK----SRIQVRLGEHNIDALEGGEQFIDAAKIIRHPNYNANTYNNDIMLIKLKTAATL 120

  Fly   129 SSTIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            :|.:..:.|..|.|:.|....||||| |||.| ::.||.||.::..::|.|.|.||   |..:|.
Mouse   121 NSRVSTVALPRSCPSAGTRCLVSGWGNTLSSG-TNYPSLLQCLDAPVLSDSSCTSS---YPGKIT 181

  Fly   193 STMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |.|.|..  ..|||:||||||||:|..|.|.||||||||||....||||..|....:|:
Mouse   182 SNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRGKPGVYTKVCKYVNWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 98/224 (44%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 98/224 (44%)
Tryp_SPc 25..243 CDD:238113 99/225 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.