DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG34436

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:288 Identity:58/288 - (20%)
Similarity:107/288 - (37%) Gaps:75/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            :.|...|:.::..|.......||.|....:...|...|.|.|| ::|....:.:|.|::.....:
  Fly     1 MNFASCLAVLSWMLANQGSAQLLDQNCAEVSRLSNDIIFSRPW-MALVLLPNKTCSGALIHKYFV 64

  Fly    67 VTAAHCLQSVSASVLQIRAGS---------SYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKI 122
            :|:|.|:.:...::  :|.|.         ||.|.   .:.|.|...|..|..:...:|||::::
  Fly    65 ITSASCVFNQERAI--VRLGQLSIKQEHIVSYSSD---DYHVQSAYIHRFYEKSNFEHDIALLEL 124

  Fly   123 NGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQL-------------QYV---- 170
            ...:.:.:.|:.|.|               |    ...|.|.:|:             :|:    
  Fly   125 QNDVLYKAHIRPICL---------------W----LDKSDIDTQMFKRYETFRWGIDEKYILPAA 170

  Fly   171 ---NVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVS--------GGVLVGVV 224
               .:..:||.:|.::...|.   :::.|||....|..|. ::|.||..        ...|.|:.
  Fly   171 KTSKIKHISQVKCENAFKLYP---QNSHICAGYKNKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQ 231

  Fly   225 SWGYG--CAYSNYPGVYADVAALRSWVI 250
            |:|..  |       :|.||.....|::
  Fly   232 SYGESRTC-------LYTDVTKYIDWIM 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 51/257 (20%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 50/247 (20%)
Tryp_SPc 40..251 CDD:214473 49/246 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.