DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG34290

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:257 Identity:63/257 - (24%)
Similarity:107/257 - (41%) Gaps:43/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LPQLDGRIVGGSATTISSFPWQISLQR----------SGSHSCGGSIYSSNVIVTAAHCLQSVSA 78
            :|.:.||||....::.|.:|:.:|||.          |..|.||||:.|...|::||||:...:.
  Fly    32 VPIVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVWRKNI 96

  Fly    79 SVLQIRAGSSYWSSGG------------VTFSVSSFKNHEGYNANTMVNDIAIIKINGAL--TFS 129
            ..:....|.....:.|            :.|..|:|:           ||||::.:....  .|.
  Fly    97 HYIAAFIGYENIENIGQLQPYGLESVEYIYFQPSNFR-----------NDIALLYMKRRYWSDFG 150

  Fly   130 STIKAIGLA--SSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASST-YGYGSQI 191
            :.::...|.  ...|....:..:.|:|. ::.:.....:|....|.::...:|.... :.:..|.
  Fly   151 NGLQYAQLPPHGMKPDQNESCRIIGYGA-THHAGPCQKRLFEAEVRVIDNQKCRDIIGHIWAPQN 214

  Fly   192 RSTMICAAASGKDACQGDSGGPLVS--GG--VLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            .:..:||..:.:|:|||||||||:.  ||  .:.|:||.|..|.....|.:|........||
  Fly   215 GANTVCALGNNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIYTVTRPYYDWV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 59/249 (24%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 62/255 (24%)
Tryp_SPc 34..276 CDD:214473 60/253 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.