DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP012472

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001687805.1 Gene:AgaP_AGAP012472 / 5668361 VectorBaseID:AGAP012472 Length:163 Species:Anopheles gambiae


Alignment Length:135 Identity:40/135 - (29%)
Similarity:64/135 - (47%) Gaps:11/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHC----LQSVSASVLQIRAGSSY 89
            ||||.|...:|.::.:.:||:....:.|||||.|...:::||||    |:::|.  :.:..||:.
Mosquito    27 GRIVNGVPVSIENYKFAVSLRIDDQYFCGGSIISVPHVLSAAHCVYPFLKNISR--MSVYGGSTS 89

  Fly    90 WSSGGVTFSVSSFKNHEGYNANTMVN----DIAIIKI-NGALTFSSTIKAIGLASSNPANGAAAS 149
            ..||||:..|....||..:..|....    |:|.:.: ..||.....:..|.:.:.....|....
Mosquito    90 PFSGGVSIPVIRAVNHPDFKPNPPSGLHDFDVAALTVPTNALRGRPNMAPISIQNVQVPAGTRCY 154

  Fly   150 VSGWG 154
            |.|||
Mosquito   155 VVGWG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 39/134 (29%)
AgaP_AGAP012472XP_001687805.1 Tryp_SPc 29..>159 CDD:304450 36/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.