powered by:
Protein Alignment gammaTry and AgaP_AGAP009000
DIOPT Version :9
Sequence 1: | NP_725034.1 |
Gene: | gammaTry / 36221 |
FlyBaseID: | FBgn0010359 |
Length: | 253 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001689205.1 |
Gene: | AgaP_AGAP009000 / 5668180 |
VectorBaseID: | AGAP009000 |
Length: | 138 |
Species: | Anopheles gambiae |
Alignment Length: | 43 |
Identity: | 12/43 - (27%) |
Similarity: | 16/43 - (37%) |
Gaps: | 6/43 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 138 ASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQC 180
|.|.|.....|..|..|..:...|..||:.:. |.|:|
Mosquito 96 ARSIPPTTRTARTSRTGRRTSPPSCTPSRTRR------STSRC 132
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
gammaTry | NP_725034.1 |
Tryp_SPc |
30..249 |
CDD:214473 |
12/43 (28%) |
AgaP_AGAP009000 | XP_001689205.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X21 |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.