DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP010618

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001688265.1 Gene:AgaP_AGAP010618 / 5667797 VectorBaseID:AGAP010618 Length:252 Species:Anopheles gambiae


Alignment Length:209 Identity:61/209 - (29%)
Similarity:90/209 - (43%) Gaps:18/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSG 93
            ||||.|:...||.:.:...:.....:.|..||.|.:..:|||||        :.||.|||....|
Mosquito    39 GRIVNGTRKDISKYKFMAIVYIQKEYVCSASIVSGSHALTAAHC--------VTIRGGSSDIFKG 95

  Fly    94 GVTFSVSSFKNHEGY------NANTMVNDIAIIKI-NGALTFSSTIKAIGLA-SSNPANGAAASV 150
            |..|.|........|      ..|...||:|::.: ..|......|..|..| |:...:|.....
Mosquito    96 GTLFQVVKITVSPNYMRTGSIARNVYDNDVAVLTVATNAFVGKPNIAPISFATSAELPSGTRCYA 160

  Fly   151 SGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLV 215
            .|||..:: ..::.::|.|....:|..:.|..: |...:.|...:||..|...:.|:||||||||
Mosquito   161 LGWGRTNF-DENLSTKLLYAEFKLVLTADCRKA-YSGKANITPNVICGKAKNSEVCEGDSGGPLV 223

  Fly   216 SGGVLVGVVSWGYG 229
            ....|.|:..:.||
Mosquito   224 CDNKLTGITFFVYG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 60/208 (29%)
AgaP_AGAP010618XP_001688265.1 Tryp_SPc 40..250 CDD:214473 60/208 (29%)
Tryp_SPc 41..252 CDD:238113 59/207 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.