DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP001245

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001689377.2 Gene:AgaP_AGAP001245 / 5667668 VectorBaseID:AGAP001245 Length:272 Species:Anopheles gambiae


Alignment Length:271 Identity:99/271 - (36%)
Similarity:150/271 - (55%) Gaps:28/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPE-----------------GL--LPQLDGRIVGGSATTISSFPWQIS 47
            :|.:::|:..|..:.....|                 ||  ||...|||.||....|:::|:|:|
Mosquito     1 MKAIVVLALFAAGVAALTEEEVWLQYNRRMPGEYYTKGLVELPPFQGRIFGGVEADIANYPYQLS 65

  Fly    48 LQRSGSHSCGGSIYSSNVIVTAAHCLQSVSA-SVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNAN 111
            |:|: |||||.|:.|:|..::||||...|.| .|:.::.|||..:||||.|.|....||..|:..
Mosquito    66 LRRA-SHSCGASVISANWALSAAHCTFPVPAPGVITLQGGSSDRTSGGVVFQVEQIINHPQYDDW 129

  Fly   112 TMVNDIAIIKINGALT-FSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIV 175
            .:|||:.:::....|: .:..|.|:....:..|.|:.|.:||||.:.  .|.:|:.|:.|::.:|
Mosquito   130 NLVNDVCVLRTTTPLSGVNIAIIALDPVGATHAVGSRAVLSGWGLME--GSVLPAILRRVDIPVV 192

  Fly   176 SQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYA 240
            .|..| .:.:|.| .:...||||:..|:|||.||||||||.||..:|:||||........|||:|
Mosquito   193 DQGAC-ETAWGSG-WVTPDMICASEPGRDACNGDSGGPLVVGGQQIGIVSWGDTQCVGTRPGVFA 255

  Fly   241 DVA--ALRSWV 249
            .||  .:|:|:
Mosquito   256 RVAFPLIRNWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 89/222 (40%)
AgaP_AGAP001245XP_001689377.2 Tryp_SPc 48..266 CDD:214473 89/222 (40%)
Tryp_SPc 49..269 CDD:238113 89/223 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.