DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP001251

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001689373.2 Gene:AgaP_AGAP001251 / 5667665 VectorBaseID:AGAP001251 Length:290 Species:Anopheles gambiae


Alignment Length:232 Identity:74/232 - (31%)
Similarity:122/232 - (52%) Gaps:18/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCL-QSVSASVLQIRAGSSYWSSGG 94
            |.||.:..|.|:|:|:||:..|:|.||.|:.:....::||||| :::..|.:..|.|:.:..:||
Mosquito    64 IFGGESVAIESYPYQLSLRLEGTHICGASVIAERWALSAAHCLDEALYPSAITFRGGTPHRLAGG 128

  Fly    95 VTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSN-----PANGAAASVSGWG 154
            ..|....:..|..::..|:..|:::..:..:. |...|:|:.||::|     |   :||.|:|||
Mosquito   129 YIFHAEYYLLHPKFDRRTLDYDVSVTHVRESF-FIDPIRAVTLANTNTYYPIP---SAAVVTGWG 189

  Fly   155 TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAAS--GKDACQGDSGGPLVSG 217
             |:......|..||.:.:.:..:..|.:||.   ..:....||..:.  ||:.|.||||||||..
Mosquito   190 -LADADGYEPLILQSLEIYLQQKQFCWTSTI---EALTDRQICGGSGVYGKETCYGDSGGPLVMN 250

  Fly   218 GVLVGVVSWGYGCAYSNYPGVYADVA--ALRSWVISN 252
            |..||:||||......|.||:|..:.  .:|:::..|
Mosquito   251 GYQVGIVSWGSDNCAVNIPGIYTSLTNDEVRAFIKLN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 73/227 (32%)
AgaP_AGAP001251XP_001689373.2 Tryp_SPc 64..277 CDD:214473 72/220 (33%)
Tryp_SPc 64..277 CDD:238113 72/220 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.