DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP001250

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001689374.2 Gene:AgaP_AGAP001250 / 5667664 VectorBaseID:AGAP001250 Length:279 Species:Anopheles gambiae


Alignment Length:240 Identity:85/240 - (35%)
Similarity:133/240 - (55%) Gaps:13/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSV-SAS 79
            ||...:|    ...|||||....|.:||:|:||:|||.|:||.|:.|....::||||...: ..:
Mosquito    43 GGASHDG----KSARIVGGRDAPIENFPYQLSLRRSGVHACGASVISLRWALSAAHCTYPIPQMN 103

  Fly    80 VLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAI-GLASSNPA 143
            .:.:|||||...:||....::...||..::..|:..|:.:::.:..:.....:..: ..|:|..|
Mosquito   104 EMSLRAGSSNRLAGGTIIPITQIINHPLFSEYTIEYDVCVLQTSTEMVGQFIVPVVLPPATSGFA 168

  Fly   144 NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ-IRSTMICAAASGKDACQ 207
            .|..|:.:|||.|:. ..|:|.|||||.:.::|..||.:|   :.|: |...|:||...|:|.|.
Mosquito   169 PGTMANATGWGLLNV-PGSLPVQLQYVALPLISLDQCRNS---WPSEWITEEMLCAGQPGRDTCG 229

  Fly   208 GDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVA--ALRSWVI 250
            ||||||||..|..:|:.|||......|.|.|:|:.|  .:||:::
Mosquito   230 GDSGGPLVINGYQMGIASWGVSECSGNLPSVFANTANPTVRSFIL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 82/223 (37%)
AgaP_AGAP001250XP_001689374.2 Tryp_SPc 53..273 CDD:214473 82/223 (37%)
Tryp_SPc 54..273 CDD:238113 81/222 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.