DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP005686

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001688706.1 Gene:AgaP_AGAP005686 / 5667393 VectorBaseID:AGAP005686 Length:297 Species:Anopheles gambiae


Alignment Length:253 Identity:81/253 - (32%)
Similarity:129/253 - (50%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQR---SGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWS 91
            ||..|.......||:|::|..   .|:..||.|:.:.|.::|||||:.....::          |
Mosquito    56 RITNGQEALPGQFPYQVALLSDFPEGTALCGASVLTRNFLLTAAHCISGTGNAL----------S 110

  Fly    92 SGGVT------------------FSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGL- 137
            |||:.                  ||.|..:.|.||:|.::.||:|::.:|..:||:|.::.|.| 
Mosquito   111 SGGIAIMGAQNRMIVELSQQRIRFSTSGIRRHPGYDATSLRNDVALVLLNSRITFTSRVQPIRLP 175

  Fly   138 --ASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAA 200
              ..:....|...:|||:|..:..|.:..:.|::.:..:::.::|.:| :|:| ..:|..:|..|
Mosquito   176 ARTDTRQFGGFTGTVSGFGRTTDSSQATSATLRFTSNPVLTNAECITS-WGFG-LAQSQNVCLKA 238

  Fly   201 S-GKDACQGDSGGPLV--SGGVL-VGVVSW--GYGCAYSNYPGVYADVAALRSWVISN 252
            | |:.||.|||||||.  |.||| :||||:  ..||| |..|.|||.|.....|:.:|
Mosquito   239 SGGRSACNGDSGGPLTVDSNGVLQIGVVSFVSAAGCA-SGRPSVYARVTYFLPWINAN 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 79/248 (32%)
AgaP_AGAP005686XP_001688706.1 Tryp_SPc 56..292 CDD:214473 79/248 (32%)
Tryp_SPc 57..295 CDD:238113 79/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.