DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP005688

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001688707.1 Gene:AgaP_AGAP005688 / 5667341 VectorBaseID:AGAP005688 Length:301 Species:Anopheles gambiae


Alignment Length:254 Identity:75/254 - (29%)
Similarity:130/254 - (51%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQR---SGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWS 91
            ||..|...|...||:||.|..   :|:..||||:.:.|.|:|||||:.|.:.:|:          
Mosquito    55 RITNGQEATPGQFPYQIILLSDFPTGTALCGGSVLTRNFILTAAHCVVSGTNTVV---------- 109

  Fly    92 SGGVT------------------FSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLA 138
            |||:.                  ::.|..:.|..|.::|:..|||::.:|.::||:..|:.:.|.
Mosquito   110 SGGIAIMGAHNRTIQEASQQRIRYTASGIRYHPLYVSSTLRYDIAVVLLNSSITFTDRIQPVRLP 174

  Fly   139 SSNPA---NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMIC-AA 199
            :.:..   .|...::||:|..:..|.||.:.:::.:..:::.:.|. :.:| .|.|:...:| :.
Mosquito   175 AQSDTRQFGGFVGTLSGFGRTTDASQSISTVVRFTSNPVMTNANCI-TRWG-SSNIQDQNVCLSG 237

  Fly   200 ASGKDACQGDSGGPLV--SGG-VLVGVVSWG--YGCAYSNYPGVYADVAALRSWVISNA 253
            ..|:.:|.|||||||.  ||| :.:||||:.  .||. :..|.||:.|:...:||..|:
Mosquito   238 TGGRSSCNGDSGGPLTVESGGPIQIGVVSFVSIRGCE-AGMPSVYSRVSFYLNWVEINS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 72/248 (29%)
AgaP_AGAP005688XP_001688707.1 Tryp_SPc 55..291 CDD:214473 72/248 (29%)
Tryp_SPc 56..292 CDD:238113 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.