DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP005705

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001688714.1 Gene:AgaP_AGAP005705 / 5667318 VectorBaseID:AGAP005705 Length:311 Species:Anopheles gambiae


Alignment Length:298 Identity:71/298 - (23%)
Similarity:127/298 - (42%) Gaps:65/298 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVACALG-GT--------------VPEGLL--------------------PQLDGRIVGGSA 36
            ::|.|||..| ||              |.|..|                    |:..|||..|..
Mosquito    14 IVSVVACVSGEGTITRLEDINWAEVRPVQESPLFKAKRAASFVERYLERVAPAPERTGRINNGVI 78

  Fly    37 TTISSFPWQISLQRS---GSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFS 98
            ...:..|:.:.:..|   |::.|||.:.|...::|:|.|::..::  :.:..|:|..:.......
Mosquito    79 VGPTDVPYIVGVLVSVEQGTYFCGGVLVSRTHVLTSATCVEGQTS--ITVLLGASDITRAQDFVV 141

  Fly    99 VSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIK--------AIGLASSNPANGAAASVSGWG- 154
            ||..:.|..:::....||:||:.::....|:..|:        .:|.:.:|    |..::|||| 
Mosquito   142 VSHVRVHPDFSSFFQANDLAILTLSRMPRFNDQIQLARLPRRSQVGESFTN----AWTTISGWGE 202

  Fly   155 TLSYGSSSIP-SQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLV--- 215
            |.|....::| .||:.|...::|...|   |..:...:||:.:|.::.|...|.||.|||:.   
Mosquito   203 TASNTGEALPMQQLRSVRSQVISNFSC---TISFPLYLRSSNVCTSSDGGAPCVGDEGGPVTIVE 264

  Fly   216 --SGGVLVGVVSWGY--GCAYSNYPGVYADVAALRSWV 249
              ....::.:.|:.|  ||..| :|.|:..|....:|:
Mosquito   265 EDGQSTVIAIHSYTYSRGCTRS-WPAVHTRVTDYLNWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 58/238 (24%)
AgaP_AGAP005705XP_001688714.1 Tryp_SPc 72..301 CDD:214473 58/238 (24%)
Tryp_SPc 73..302 CDD:238113 58/239 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.