DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP006485

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001688885.1 Gene:AgaP_AGAP006485 / 5667297 VectorBaseID:AGAP006485 Length:281 Species:Anopheles gambiae


Alignment Length:262 Identity:68/262 - (25%)
Similarity:118/262 - (45%) Gaps:21/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLS-AVACALGGTV-PEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            ||:.|: |:.|..|..| .|...|    |::||:......||..:|:..:.:..|||::.....:
Mosquito     6 FVLCLAVALPCIRGDNVESEDRSP----RLIGGTNAPWGQFPSAVSINTTFNVHCGGAVVDRQHV 66

  Fly    67 VTAAHC-----LQSVSASVLQIRAGSSYWSSGGV---TFSVSSFKNHEGYNANTMVNDIAIIKIN 123
            :|||.|     |:.|....:.:|||....:..|.   |..||....|..:|..|:.:|:|:::::
Mosquito    67 LTAAQCVFNANLRLVDPYWITVRAGDIALAPVGARRQTRKVSHIFVHPQFNIRTLEHDVAVLRLD 131

  Fly   124 GALTF-SSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQ-YVNVNIVSQSQCASSTYG 186
            ..... |:||...........|||:...:|||..:...::..:.|| ::.:.:..:..|..:...
Mosquito   132 RPYDLPSNTINLANRTRRIVPNGASCQFAGWGASTAALNAPVNVLQRFLPMTVNDRDMCNQANMH 196

  Fly   187 YGSQIRSTMICAAASGKD----ACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRS 247
            .|..:.| .:||..:|..    .|.|::|..|.....|||.:|:|..|..:|.|.|:..|.....
Mosquito   197 AGRMLES-HLCAGNTGGSNNAAPCNGNAGTGLYCERALVGTLSFGLNCGAANNPPVFTQVRFYND 260

  Fly   248 WV 249
            |:
Mosquito   261 WI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 58/232 (25%)
AgaP_AGAP006485XP_001688885.1 Tryp_SPc 30..262 CDD:214473 58/232 (25%)
Tryp_SPc 32..265 CDD:238113 58/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.