DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP006673

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001688952.1 Gene:AgaP_AGAP006673 / 5667010 VectorBaseID:AGAP006673 Length:307 Species:Anopheles gambiae


Alignment Length:246 Identity:69/246 - (28%)
Similarity:125/246 - (50%) Gaps:25/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQ---ISLQRSGSHS-CGGSIYSSNVIVTAAHCL-----QSVSASVLQIRA 85
            ||..|...|...||:|   .|....|.:| |||:|.::..::|||||:     ::|:..::.:.|
Mosquito    59 RITNGQLATAGQFPYQAVVYSEAGDGYYSLCGGTILTTTYVLTAAHCVTDDFDRAVTGGIVFLGA 123

  Fly    86 GSS---YWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPA---N 144
            ...   ..:...::|..:..:.|..||:.::.||||.::::.|..|::.:|||.|.:.:.|   .
Mosquito   124 TDRTVFQSTQQRMSFGNAGIRVHPQYNSTSIRNDIATVRLDTAAIFNTYVKAIDLPALSDARQFG 188

  Fly   145 GAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICA-AASGKDACQG 208
            |...:.||:|..:....:..:.|.:|...:::.:||  :.|...:.:::..:|. ...|:.||.|
Mosquito   189 GFEGTASGFGRTADTVPAASNVLMFVRNPVMTNAQC--NAYWSTAVVQAQNVCLDPYGGRSACHG 251

  Fly   209 DSGGPLV---SGGVL-VGVVSW--GYGCAYSNYPGVYADVAALRSWVISNA 253
            ||||||.   :|..| ||:.|:  ..||. |..|.|:..|:..|.::..|:
Mosquito   252 DSGGPLAVQDAGRSLQVGIASFVSANGCT-SGAPSVWVRVSYFRDFISQNS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 68/240 (28%)
AgaP_AGAP006673XP_001688952.1 Tryp_SPc 59..297 CDD:214473 68/240 (28%)
Tryp_SPc 60..300 CDD:238113 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.