DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CLIPC6

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_001687772.2 Gene:CLIPC6 / 5666762 VectorBaseID:AGAP000315 Length:361 Species:Anopheles gambiae


Alignment Length:292 Identity:80/292 - (27%)
Similarity:130/292 - (44%) Gaps:52/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVACALGGTVPEGL--------LPQLDGR----IVGGSATTISSFPWQISL--------QRS 51
            |...:.|...||.|.|:        :|:...|    |:.|...:...||:..:|        |::
Mosquito    71 LTEVICCKTNGTRPLGVRSRLACEQVPKYTSRLTFHIIDGEEASEGEFPFMAALGYPTDDETQQN 135

  Fly    52 GSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSG--GVTFSVSSFKNHEGYNANTMV 114
            .|:.||.|:.|::.::|||||:.:.....:.| .|::..:.|  ||...:.:|..|..|..|...
Mosquito   136 ISYRCGASMISTDFLLTAAHCIPTNDRPTVAI-LGTNNLAPGNHGVLVGLKAFFPHPDYRTNRNY 199

  Fly   115 NDIAIIKINGALTFSSTIKAIGLAS--SNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQ 177
            :|||::::...:.....:..|.|..  |:.......:..|:|.:....:...:||..||:..|..
Mosquito   200 HDIALVQLERRIENEPDVNPICLNDDLSDLPEDTVLTAEGYGIIDLDRNLRSNQLMKVNLTTVPW 264

  Fly   178 SQCASSTYGYGSQIR----------STMICAAASGK---------DACQGDSGGPL--VSGG--V 219
            .:| :.|:...:.::          :|..|  |:|:         |.|||||||||  :..|  .
Mosquito   265 QKC-NQTFADSNLLKNNRKLPQGIVATQYC--ATGRENEEKKVVGDTCQGDSGGPLQIMDDGKYK 326

  Fly   220 LVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            ||||.|:|.||. ||.|.|...|||...|:.|
Mosquito   327 LVGVTSFGNGCG-SNTPSVSTRVAAYIDWIES 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 71/257 (28%)
CLIPC6XP_001687772.2 CLIP 31..77 CDD:288855 1/5 (20%)
Tryp_SPc 106..355 CDD:214473 70/253 (28%)
Tryp_SPc 107..358 CDD:238113 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.