DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and KLK10

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:272 Identity:78/272 - (28%)
Similarity:112/272 - (41%) Gaps:42/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRI---VGGSATTISSFPWQISLQRSGSHSCGGSIYS 62
            :.|.:.||.|...|    ....||||.|.|:   ..||.....|.|||:||....|..|.|.:..
Human    17 LAKLLPLLMAQLWA----AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVD 77

  Fly    63 SNVIVTAAHCLQSVSASVLQIRAGSSYWSSGG--------------VTFSVSSFKNHEGYN---- 109
            .:.::|||||            .....|:..|              .|.||...|.|:|..    
Human    78 QSWVLTAAHC------------GNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILP 130

  Fly   110 ANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNI 174
            ..|..:|:.::|:...:.....::|:.|.......|....|:||||.:.........|...::.|
Human   131 RRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITI 195

  Fly   175 VSQSQCASSTYGYGSQIRSTMICAAAS-GKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPG 237
            :|..:|   ...|...:.:.||||... |:|.||.|||||||....|.|::||| |.|..:.:|.
Human   196 LSPKEC---EVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPA 257

  Fly   238 VYADVAALRSWV 249
            ||..:....||:
Human   258 VYTQICKYMSWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 67/241 (28%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 67/236 (28%)
Tryp_SPc 49..269 CDD:214473 66/234 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.