DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:164 Identity:62/164 - (37%)
Similarity:83/164 - (50%) Gaps:20/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 HEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPA--NGAAASVSGWGTLSYGSSSIPSQL 167
            |..||.:|...||.:||::..:..:..:....|...|..  .|....|||||:.|:....||..|
Zfish    31 HPLYNRSTNNADIMLIKLSAPIELNRYVSLAPLPKQNTGLLAGRMCRVSGWGSTSHSGGLIPLTL 95

  Fly   168 QYVNVNIVSQSQCASSTYGYGSQIRSTMICAAAS--GKDA---------------CQGDSGGPLV 215
            :.|.:.|||..:|.||: .:...|.:.||||.:|  ||||               ||||||||||
Zfish    96 RTVRLPIVSTFKCNSSS-SFSGNITANMICAGSSTGGKDACKNSTQYLCHLIVYLCQGDSGGPLV 159

  Fly   216 SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ..|.:.|:||||.||....:||||..|:..|.|:
Zfish   160 CDGRVYGLVSWGNGCGDPRFPGVYTAVSRFRRWI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 61/162 (38%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 62/164 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.