DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and PRSS3

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:228 Identity:89/228 - (39%)
Similarity:133/228 - (58%) Gaps:15/228 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWS- 91
            |.:||||.....:|.|:|:|| .||||.||||:.|...:|:||||.:    :.:|:|.|..... 
Human   107 DDKIVGGYTCEENSLPYQVSL-NSGSHFCGGSLISEQWVVSAAHCYK----TRIQVRLGEHNIKV 166

  Fly    92 -SGGVTF-SVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWG 154
             .|...| :.:....|..||.:|:.|||.:||::.....::.:..|.|.::.||.|....:||||
Human   167 LEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWG 231

  Fly   155 -TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVS 216
             |||:| :..|.:|:.::..:::|::|.:|   |..:|.::|.|..  ..|||:||.|||||:|.
Human   232 NTLSFG-ADYPDELKCLDAPVLTQAECKAS---YPGKITNSMFCVGFLEGGKDSCQRDSGGPVVC 292

  Fly   217 GGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            .|.|.||||||:|||:.|.||||..|.....|:
Human   293 NGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 87/224 (39%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 87/224 (39%)
Tryp_SPc 110..328 CDD:238113 88/225 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.