DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:255 Identity:93/255 - (36%)
Similarity:133/255 - (52%) Gaps:20/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQ-RSGSHSCGGSIYSSNVIVTAA 70
            ||..:.|.|...:.......:..|||||......|..:.:|:| .:|.|.|||::.:...::|||
Zfish     3 LLLLLLCVLLEILAVSCQDVIQARIVGGYVPAPYSIKYIVSIQSATGQHFCGGTLINKYWVLTAA 67

  Fly    71 HCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKN------HEGYNANTMVNDIAIIKINGALTFS 129
            ||  ::..:.::|.||.   .|.|:...:..|:.      |..|:.:|...||.:||:...:..:
Zfish    68 HC--NIGEANMRIVAGD---YSVGLYEGMEQFRRPHMLIPHPQYDRSTNNADIMLIKLQSPVYLN 127

  Fly   130 STIKAIGLASSNP--ANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191
            |.:..:.|...:.  |.|...|||||| |.|.|  .|.|.|:.|.:.|||.:.| :.|..:...|
Zfish   128 SYVSLVPLPRQDAMVAVGRLCSVSGWGFTTSTG--GISSILRTVKLPIVSTAVC-NGTDSFNGNI 189

  Fly   192 RSTMICAAAS--GKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ...||||..|  |||||:||||||||..|.:.|:||||.|||.:.|||||..|:..|.|:
Zfish   190 TENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADAQYPGVYTAVSQFRQWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 88/230 (38%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 88/230 (38%)
Tryp_SPc 27..252 CDD:238113 88/231 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.