DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and tmprss13a

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001152984.1 Gene:tmprss13a / 559754 ZFINID:ZDB-GENE-090309-3 Length:506 Species:Danio rerio


Alignment Length:242 Identity:88/242 - (36%)
Similarity:129/242 - (53%) Gaps:26/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYW 90
            |...||:||:.:.:..:|||:||..:.:|.|||::.|.:.||:||||.|...|:       |:||
Zfish   264 QSSSRIIGGTTSELGQYPWQVSLHYNKAHVCGGTLISPDFIVSAAHCFQGKMAN-------SAYW 321

  Fly    91 ---------SSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNP--AN 144
                     .|.|:.:.|......|.||::|..||:|::.::..:.||.|.:.:.|.:.|.  :.
Zfish   322 LVYVGIVSQQSLGMPYLVKKIIVSEKYNSDTNDNDVALLILSRPVAFSYTTQPVCLPTFNQTFSG 386

  Fly   145 GAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQ 207
            |.....||:||...|:....|.|..|:|||:..|.| :|...|...|.:.||||.  ..|:|:||
Zfish   387 GLQCWTSGFGTTKQGADRASSSLMSVSVNIIDSSVC-NSCQIYCGLITNNMICAGDLKGGRDSCQ 450

  Fly   208 GDSGGPLV-----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||||||||     :...|||:.|||.||.....||||:.|.:...|:
Zfish   451 GDSGGPLVCKDDNNRWYLVGITSWGAGCGQKQKPGVYSRVTSFLPWI 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 86/236 (36%)
tmprss13aNP_001152984.1 SRCR_2 178..261 CDD:295335
Tryp_SPc 268..497 CDD:214473 86/236 (36%)
Tryp_SPc 269..497 CDD:238113 85/235 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.