DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and KLK15

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:260 Identity:82/260 - (31%)
Similarity:130/260 - (50%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVACALGGTVPEGLLPQLDG-RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAA 70
            ||..::..|..|..:      || :::.|......|.|||::|...|..:||.|:.|.:.:::||
Human     3 LLLTLSFLLASTAAQ------DGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAA 61

  Fly    71 HCLQSVSASVLQIRAGS-SYWSSGG--VTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTI 132
            ||    .:..:::|.|. :.....|  ...:.|....|..|.|.:..|||.::::......:..:
Human    62 HC----QSRFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQV 122

  Fly   133 KAIGLASSNPANGAAASVSGWGTLSY------GSS----SIPSQLQYVNVNIVSQSQCASSTYGY 187
            :...|.:..|..|.|..|||||.:|:      ||.    |:|..|...|::|:|.:.|..|   |
Human   123 RPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKS---Y 184

  Fly   188 GSQIRSTMICAAASGK--DACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSWV 249
            ..::.:||:||.|.|:  ::|:||||||||.||:|.|:|||| ..|..:..||||..|.....|:
Human   185 PGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWI 249

  Fly   250  249
            Human   250  249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/234 (32%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 75/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.