DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and f2

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001015797.1 Gene:f2 / 548514 XenbaseID:XB-GENE-481539 Length:607 Species:Xenopus tropicalis


Alignment Length:257 Identity:78/257 - (30%)
Similarity:122/257 - (47%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDGRIVGGSATTISSFPWQISLQRSGSHS--CGGSIYSSNVIVTAAHCL------QSVSASVLQI 83
            :.||||.|......|.|||:.|.:.....  ||.|:.|...:::||||:      ::.:...:.:
 Frog   346 MQGRIVKGETAEPGSAPWQVMLFKKSPQELLCGASLLSDRWVLSAAHCIFYPPWDKNYTTDDILV 410

  Fly    84 RAGSSYWSS-GGVTFSVSSFKN---HEGYN-ANTMVNDIAIIKINGALTFSSTIKAIGLASSNP- 142
            |.|..:.:. ...|..::..:.   |..|| ...:..|||:|::...:.||:.|..:.|.:.:. 
 Frog   411 RIGKHFRTKYERATERIAQLERIIVHPKYNWKENLDRDIALIQLKRPVAFSNYIHPVCLPTKDTV 475

  Fly   143 ----ANGAAASVSGWGTL----SYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA 199
                |.|....|:|||.|    :.|:.::|..||.:|:.||.|..|.|||   ..::...|.||.
 Frog   476 VKLLAAGYKGRVTGWGNLQETWTSGAQNLPQALQQINLPIVDQETCKSST---NIKVTDNMFCAG 537

  Fly   200 ASGK-----DACQGDSGGPLV------SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVI 250
            .:.:     |||:||||||.|      ...|.:|:||||.||...|..|.|..|..:|.|::
 Frog   538 YNPEDSKRGDACEGDSGGPFVMKDPDTGRWVQLGIVSWGEGCDRDNKYGFYVHVHRMRKWIM 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 76/251 (30%)
f2NP_001015797.1 GLA 23..86 CDD:214503
KR 106..185 CDD:214527
KR 206..287 CDD:214527
Thrombin_light 303..349 CDD:370463 0/2 (0%)
Tryp_SPc 349..598 CDD:214473 76/251 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.