DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and tpsg1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_012826218.1 Gene:tpsg1 / 548372 XenbaseID:XB-GENE-5893000 Length:297 Species:Xenopus tropicalis


Alignment Length:241 Identity:82/241 - (34%)
Similarity:121/241 - (50%) Gaps:21/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYW 90
            ::|.|||||........|||:.:...||..|||::.|||::||.|||:...:||.:.:..| :|.
 Frog    52 KIDNRIVGGQDAMKGKNPWQVIVWIPGSGYCGGALISSNLVVTVAHCIDGFNASSVVVILG-AYK 115

  Fly    91 SSGGV----TFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPA--NGAAAS 149
            .:|..    :..|.....|..||.:....|||:::::..:..:..|:.:.:.|::..  .|....
 Frog   116 ITGNPNEENSVPVQQIIIHPSYNESDNSADIALLQLSQNVPITRYIQPVCVPSASTVFPPGQNCV 180

  Fly   150 VSGWGTLSYGSSSIPSQ---LQYVNVNIVSQSQCAS--STYGYGSQIRSTMICAA--ASGKDACQ 207
            |:|||.:..  |.||.:   ||...|.::|..||.|  ...|.||.|:..||||.  ...:..|.
 Frog   181 VTGWGDIEL--SVIPQRPVVLQETQVRLMSTEQCKSYYDNKGVGSFIKDDMICAVDILGQRGPCL 243

  Fly   208 GDSGGPLVS----GGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||.|||||:    ...||||.|:|:||...| |.||..|.|...|:
 Frog   244 GDGGGPLVTYQNKQWNLVGVASFGFGCGNEN-PAVYTSVRAYIDWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 80/235 (34%)
tpsg1XP_012826218.1 Tryp_SPc 56..288 CDD:214473 80/235 (34%)
Tryp_SPc 57..290 CDD:238113 80/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.